Protein Info for PP_1459 in Pseudomonas putida KT2440

Annotation: CBS domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 47 to 70 (24 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details PF01595: CNNM" amino acids 72 to 148 (77 residues), 37.4 bits, see alignment E=3.1e-13 PF00571: CBS" amino acids 258 to 306 (49 residues), 33.5 bits, see alignment 6.6e-12 PF03471: CorC_HlyC" amino acids 323 to 396 (74 residues), 52.8 bits, see alignment E=4.8e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1459)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MV9 at UniProt or InterPro

Protein Sequence (401 amino acids)

>PP_1459 CBS domain protein (Pseudomonas putida KT2440)
MDTLPYAPLFGTLALALLWSALFTAVEAARLQLNGTLRAGEDGHPVLPAQALVLCASLGK
LLVLGLACLVGQRQSGEHGFWLAGLAATLTLLVFAEYLPRRLARRNPQAFVSLGASLLKV
PLALLQPLACLLDGAAKLILRPFRAQPTAVALHTQEADDFDEDEQHEAPRQGLLDGLQSL
DKITVNDILVPRNEVDGINLDEPIERIVEQLIVSRHTRLPVYHNDINQVEAILNTKLISH
LLPKAELTLEALHSACYEPYFVPESTPLQMQLLNFHKQQRRLGVVVDEYGEVLGIVTLED
ILEEIVGEFEDEQSLENPHVHPQPDGTFVIDGTASLREINRTLSWHLPCDGGPKTLNGLV
TEALESIPESAVCLKIGRYRLEILETEDNCASKVLVWTVTR