Protein Info for PP_1450 in Pseudomonas putida KT2440

Annotation: putative Activation/secretion protein, TPS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF08479: POTRA_2" amino acids 84 to 158 (75 residues), 62.5 bits, see alignment E=4.1e-21 PF17287: POTRA_3" amino acids 160 to 212 (53 residues), 45.3 bits, see alignment 6.8e-16 PF03865: ShlB" amino acids 217 to 526 (310 residues), 277.3 bits, see alignment E=3.2e-86

Best Hits

KEGG orthology group: K11017, hemolysin activation/secretion protein?? (inferred from 100% identity to ppu:PP_1450)

Predicted SEED Role

"Channel-forming transporter/cytolysins activator of TpsB family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MW8 at UniProt or InterPro

Protein Sequence (565 amino acids)

>PP_1450 putative Activation/secretion protein, TPS family (Pseudomonas putida KT2440)
MRGASMPCLIHRIAHWLSAGCLSGLLSIPQVLADDPASQQLRDQQHGLRQLEQQQRLERW
QRIPVPAEPTNSTSHRPHDDRCWAVDGVRVAGMHRLSNSALAPTIRALTPACMGIADINR
LLKAITQRYVQAGYPTSRPYLRQPPAEGMPLDIVIVEGFVETIELAGPDLPLSLSSAFPG
LLGQPLYLPDLEQGLDQLNRLRAYELGATLLPGELQGGTRVVVQPGKVASRWHLDSRFDN
RGSELTGRHRVNLGIGLDSPLGLNDELRLSLARTVLDTPGQSQGISLYYSIPYGAWTFAL
SASQLSYQAPLPYSDKAADGSSSYQGLSVERVLWRNQQGMLSASARLDRKQLINRSAGAV
IVQQSPTLATVEAGINLLWLESGLWNGYFGVAQGIDALGADRSPLGAHRLRPDFRKYRAN
LLHLRQGPAPSPWRWQSELAMQYSRDPLPAVEQLLVSDDSAVRGFRLHTYSGASSAVWRN
TFSQALPRTWAPPFEIRPYIGLDLGWVRTAEGKPSQRLAGAAAGLELSLPGSRLRLDYQR
ALYTSDLPRPRLEPGFWVLDWTLSI