Protein Info for PP_1444 in Pseudomonas putida KT2440

Annotation: quinoprotein glucose dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 803 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 66 to 82 (17 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details TIGR03074: membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family" amino acids 16 to 801 (786 residues), 1147.4 bits, see alignment E=0 PF01011: PQQ" amino acids 228 to 256 (29 residues), 22.1 bits, see alignment (E = 1.4e-08) amino acids 308 to 341 (34 residues), 22.5 bits, see alignment (E = 1.1e-08) amino acids 675 to 710 (36 residues), 25.9 bits, see alignment (E = 8.8e-10) amino acids 736 to 767 (32 residues), 26.5 bits, see alignment (E = 5.9e-10) PF13360: PQQ_2" amino acids 683 to 769 (87 residues), 19.8 bits, see alignment E=8.5e-08

Best Hits

Swiss-Prot: 48% identical to DHG_GLUOX: Quinoprotein glucose dehydrogenase (gdh) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K00117, quinoprotein glucose dehydrogenase [EC: 1.1.5.2] (inferred from 100% identity to ppu:PP_1444)

Predicted SEED Role

"Glucose dehydrogenase, PQQ-dependent (EC 1.1.5.2)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway or Respiratory dehydrogenases 1 (EC 1.1.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MX4 at UniProt or InterPro

Protein Sequence (803 amino acids)

>PP_1444 quinoprotein glucose dehydrogenase (Pseudomonas putida KT2440)
MSTEGANQGSRWLPRLIGALLLLMGLALLAGGIKLSQLGGSLYYLIAGIGFALSGVLLLA
QRQIALGLYGLVLLGSTVWALFEVGLDWWQLVPRLAIWFAIGVVLLLPWARRPLIGPASK
ANTALLGVAVVASGACALASQFTHPGEVFGELGRDSSEMASAAPAMPDGEWQAYGRTEHG
DRYSPLRQITPQNAYRLEEAWRIRTGDLPTENDPVELTNQNTPLKVNGMLYACTAHSRLL
ALDPDTGAEIWRYDPQVKSPTGTFKGFAHMTCRGVSYYDENRYVSRDGSPAPKITDAGQA
VAQACPRRLYLPTADARLIAINADNGKVCEGFANQGVIDLTTGIGPFTAGGYYSTSPAAI
TRDLVIIGGHVTDNESTNEPSGVIRAYDVHDGHLVWNWDSNNPDDTKPLAAGKMYSRNSA
NMWSIASVDEDLGMIYLPLGNQTPDQWGADRTPGAEKYSAGVVALDLATGKARWNYQFTH
HDLWDMDVGSQPTLVHLKTDDGVKPAIIVPTKQGSLYVLDRRDGTPIVPIREIPTPQGAV
EGDHTSPTQARSDLNLLGPELTEQAMWGATPFDQMLCRIQFRELRYEGQYTPPSEQGSLV
YPGNVGVFNWGSVSVDPVRQLLFTSPNYMAFVSKMVPREQVAEGSKRESETSGVQPNTGA
PYAVIMHPFMSPLGVPCQAPAWGYVAAIDLFTNKVVWKHKNGTTRDSTPLPIGLPVGVPS
MGGSIVTAGGVGFLSGTLDQYLRAYDVNNGKELWKARLPAGGQATPMSYTGKDGKQYVLV
TAGGHGSLGTKMGDYIIAYKLAE