Protein Info for PP_1441 in Pseudomonas putida KT2440

Annotation: tRNA (cmo5U34)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR00740: tRNA (cmo5U34)-methyltransferase" amino acids 6 to 246 (241 residues), 288 bits, see alignment E=3.3e-90 PF00891: Methyltransf_2" amino acids 56 to 178 (123 residues), 24.6 bits, see alignment E=3.8e-09 PF13847: Methyltransf_31" amino acids 57 to 177 (121 residues), 28.5 bits, see alignment E=2.9e-10 PF08241: Methyltransf_11" amino acids 63 to 167 (105 residues), 42.7 bits, see alignment E=1.9e-14 PF08242: Methyltransf_12" amino acids 63 to 165 (103 residues), 37.3 bits, see alignment E=9.7e-13 PF13649: Methyltransf_25" amino acids 63 to 163 (101 residues), 45.4 bits, see alignment E=2.7e-15

Best Hits

Swiss-Prot: 100% identical to CMOA_PSEPK: Carboxy-S-adenosyl-L-methionine synthase (cmoA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K15256, tRNA (cmo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to ppu:PP_1441)

MetaCyc: 56% identical to carboxy-S-adenosyl-L-methionine synthase (Escherichia coli K-12 substr. MG1655)
RXN0-7066

Predicted SEED Role

"tRNA (uridine-5-oxyacetic acid methyl ester) 34 synthase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MX7 at UniProt or InterPro

Protein Sequence (247 amino acids)

>PP_1441 tRNA (cmo5U34)-methyltransferase (Pseudomonas putida KT2440)
MSKQPDRLFSQPLEQVPDFVFNEDVVRVFPDMIKRSVPGYPTIVENLGVLAARFAQPGTA
LYDLGASLGAVTQSLRRHVRSDGCRVIAVDNSAAMVERCRQYLTAQDSMFQELLPVQVLE
ADILALPFEPASVVAMNFTLQFIAPDQRLELLGRIRQALLPGGALILSEKLRFADEQEQD
LLNELHLDFKRANGYSELEIAQKRSAIENVMKPDTLETHQERLRAAGFSKVVPWFQCLNF
ASLIALP