Protein Info for PP_1426 in Pseudomonas putida KT2440

Annotation: L-aspartate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00551: L-aspartate oxidase" amino acids 6 to 520 (515 residues), 667.5 bits, see alignment E=5.6e-205 PF01266: DAO" amino acids 8 to 111 (104 residues), 31.8 bits, see alignment E=2.2e-11 PF00890: FAD_binding_2" amino acids 8 to 392 (385 residues), 349.7 bits, see alignment E=5.7e-108 PF02910: Succ_DH_flav_C" amino acids 441 to 525 (85 residues), 54.7 bits, see alignment E=2.2e-18

Best Hits

Swiss-Prot: 86% identical to NADB_PSEAE: L-aspartate oxidase (nadB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00278, L-aspartate oxidase [EC: 1.4.3.16] (inferred from 100% identity to ppu:PP_1426)

Predicted SEED Role

"L-aspartate oxidase (EC 1.4.3.16)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 1.4.3.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MZ2 at UniProt or InterPro

Protein Sequence (534 amino acids)

>PP_1426 L-aspartate oxidase (Pseudomonas putida KT2440)
MSQQFQHDVLVIGSGAAGLSLALNLPSHLRVAVLSKGDLSNGSTFWAQGGVAAVLDNTDT
VQSHVEDTLNAGGGLCHEDAVRFTVEHSREAIQWLIEQGVPFTRDEHYSVDDGGFEFHLT
REGGHSHRRIIHAADATGAAIFTTLLEQARQRPNIQLLEQRVAVDLITERRLGLPGERCL
GAYVLDRNTGEVDTFGARFTVLATGGAAKVYLYTSNPDGACGDGIAMAWRAGCRVANLEF
NQFHPTCLYHPQAKSFLITEALRGEGALLRLPNGERFMPRFDPREELAPRDIVARAIDHE
MKRLGVDCVYLDITHKPADFIKSHFPTVYERCLAFGIDITRQPIPVVPAAHYTCGGVMVD
DCGHTDVPGLYAIGETSFTGLHGANRMASNSLLECFVYGRAAAADIQAHLEQVAMPKALP
GWDASQVTDSDEDVIIAHNWDELRRFMWDYVGIVRTSKRLQRAQHRIRLLLDEIDEFYSN
YKVSRDLIELRNLAQVAELMILSAMQRKESRGLHYTLDYPGMLDEAKDTILNPL