Protein Info for PP_1421 in Pseudomonas putida KT2440

Annotation: putative Sensor histidine kinase TctE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 35 (16 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details PF08521: 2CSK_N" amino acids 23 to 170 (148 residues), 144.6 bits, see alignment E=5.7e-46 PF00672: HAMP" amino acids 196 to 243 (48 residues), 30.3 bits, see alignment 1e-10 PF26769: HAMP_PhoQ" amino acids 198 to 243 (46 residues), 33.5 bits, see alignment 8.6e-12 PF00512: HisKA" amino acids 249 to 313 (65 residues), 58.1 bits, see alignment E=1.9e-19 PF02518: HATPase_c" amino acids 362 to 459 (98 residues), 75.8 bits, see alignment E=9.1e-25

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 100% identity to ppu:PP_1421)

Predicted SEED Role

"Tricarboxylate transport sensor protein TctE"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MZ7 at UniProt or InterPro

Protein Sequence (463 amino acids)

>PP_1421 putative Sensor histidine kinase TctE (Pseudomonas putida KT2440)
MSTAMRDNGSLRGRLLGNLALLLVVLMLASGLSAYWNGREAADTAYDRTLLASARTIAAG
LSQRDGSLSADVPYVALDTFAYDSAGRIYYQVLDIKQRLISGYENLPPPPPGTPRTDDYP
ALARFYNATYLGQDVRVVSLLKPVSEPNMNGMAEIRVAETEEARVRMARGLMADTLLRLG
MLALGALVMVWFAVSAALRPLERLRTAVEERQPDDLRALPVVQVQRELGPLVRALNHFTE
RLRGQFERQAQFIADAAHELRTPLAALKARVELGLRSAEPQEWRQTLESAAQGTDRLTHL
ANQLLSLARVENGARAIAEGGAQRLDLSQLARELGMAMAPLAHKRGVALALEAEAPVWLK
GEPTLLNELLSNLVDNALAHTPAGGNVILRVMAPAVLEVEDDGPGIPVAERERVFERFYR
RSAQGSGLGLAIVGEICRAHLAQVTLHDGEKGGLRVRVSFIAD