Protein Info for PP_1416 in Pseudomonas putida KT2440

Annotation: putative Tricarboxylate transport protein TctA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 45 to 72 (28 residues), see Phobius details amino acids 109 to 134 (26 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 248 to 256 (9 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details amino acids 385 to 427 (43 residues), see Phobius details amino acids 433 to 452 (20 residues), see Phobius details amino acids 467 to 490 (24 residues), see Phobius details PF01970: TctA" amino acids 20 to 440 (421 residues), 496.9 bits, see alignment E=2.1e-153

Best Hits

KEGG orthology group: K07793, putative tricarboxylic transport membrane protein (inferred from 100% identity to ppu:PP_1416)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N02 at UniProt or InterPro

Protein Sequence (504 amino acids)

>PP_1416 putative Tricarboxylate transport protein TctA (Pseudomonas putida KT2440)
MDTLSYLGQGFGIALSPYNLVTALSGTLIGTVVGLLPGLGPINGVALLIPIAFALGLPPE
SALILLAAVYLGCEYGGRISSILLNIPGEASTVMTTLDGYPMARQGLAGVALSLSAWSSF
IGAFIATCGMVLFAPLLAKWAIAFGPAEYFVLMVFAIVALGGMAGDKPLKTFIAALIGLF
LSAVGIDANSGVYRFTGDSVHLADGIQFVVLVLGLFSISEILLLLEKTHHGHQAVKATGR
MLFNFKEAASVFLVNIRCGLLGFIMGVLPGAGATLASAVAYMTEKRMAGESGKFGKGDAR
GLAAPETAIGASCCGALVPMLTLGVPGSGTTAVMIGALTLYNITPGPLLFEQQPDIVWGL
IASLFVANIMLVILNIPMIRIFTRILAVPNWALVPVIAIITAIGVYAVHATTFDLFLMVG
IGIMGYIMRKLDFPLSPILLGFILGGLMEQNLRRALSISNGELGILWSSPISMGIWALVV
VMLALPLLRIWRKRSLQRRALADA