Protein Info for PP_1409 in Pseudomonas putida KT2440

Annotation: ribosomal small subunit pseudouridine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF01479: S4" amino acids 1 to 42 (42 residues), 26.2 bits, see alignment 5.4e-10 PF00849: PseudoU_synth_2" amino acids 62 to 190 (129 residues), 68.1 bits, see alignment E=1e-22 TIGR00093: pseudouridine synthase" amino acids 66 to 223 (158 residues), 143.2 bits, see alignment E=2.9e-46

Best Hits

Swiss-Prot: 66% identical to RSUA_PSEAE: Ribosomal small subunit pseudouridine synthase A (rsuA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06183, ribosomal small subunit pseudouridine synthase A [EC: 5.4.99.12] (inferred from 98% identity to ppf:Pput_4313)

Predicted SEED Role

"Ribosomal small subunit pseudouridine synthase A (EC 4.2.1.70)" (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FW19 at UniProt or InterPro

Protein Sequence (230 amino acids)

>PP_1409 ribosomal small subunit pseudouridine synthase A (Pseudomonas putida KT2440)
MRLDRFLANLPSYNRQNVRLMLAQRRVRVDGQVVSDPLTDVREFSRVELDEQLLQAGRPA
RYLMLYKPTGCVSATHDPQHRTVLDLLPAALRDDLHIAGRLDFNTTGLMILTNDGQWSRR
LTQPATKLPKHYLVDTEDEIGEHYVAKFREGFYFAFEDLTTQPAQLDILGPHRARLAIVE
GRYHQVKRMFGHFNNKVIGLHRESMGAIRLDPGLAPGEYRELTANEIATV