Protein Info for PP_1408 in Pseudomonas putida KT2440

Annotation: (R)-3-hydroxydecanoyl-ACP:CoA transacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12146: Hydrolase_4
  • amino acids 26 to 253 (228 residues), 33.8 bits, E=3.5e-12
• PF00561: Abhydrolase_1
  • amino acids 29 to 256 (228 residues), 64.7 bits, E=1.7e-21
• PF12697: Abhydrolase_6
  • amino acids 30 to 255 (226 residues), 29 bits, E=2.5e-10

Best Hits

Swiss-Prot: 100% identical to PHAG_PSEPK: (R)-3-hydroxydecanoyl-ACP:CoA transacylase (phaG) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1408)

MetaCyc: 100% identical to 3-hydroxyacyl-CoA-acyl carrier protein transferase (Pseudomonas putida KT2440)
2.4.1.-

Predicted SEED Role

"(R)-3-hydroxydecanoyl-ACP:CoA transacylase PhaG (3-hydroxyacyl-CoA-acyl carrier protein transferase) (EC 2.4.1.-)" in subsystem Rhamnolipids in Pseudomonas (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See O85207 at UniProt or InterPro

Protein Sequence (295 amino acids)

>PP_1408 (R)-3-hydroxydecanoyl-ACP:CoA transacylase (Pseudomonas putida KT2440)
MRPEIAVLDIQGQYRVYTEFYRADAAENTIILINGSLATTASFAQTVRNLHPQFNVVLFD
QPYSGKSKPHNRQERLISKETEAHILLELIEHFQADHVMSFSWGGASTLLALAHQPRYVK
KAVVSSFSPVINEPMRDYLDRGCQYLAACDRYQVGNLVNDTIGKHLPSLFKRFNYRHVSS
LDSHEYAQMHFHINQVLEHDLERALQGARNINIPVLFINGERDEYTTVEDARQFSKHVGR
SQFSVIRDAGHFLDMENKTACENTRNVMLGFLKPTVREPRQRYQPVQQGQHAFAI