Protein Info for PP_1389 in Pseudomonas putida KT2440

Annotation: Oxaloacetate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13714: PEP_mutase
  • amino acids 15 to 248 (234 residues), 141.9 bits, E=1.3e-45

Best Hits

Swiss-Prot: 100% identical to OADC_PSEP1: Oxaloacetate decarboxylase (Pput_4334) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K01003, carboxyvinyl-carboxyphosphonate phosphorylmutase [EC: 2.7.8.23] (inferred from 99% identity to ppg:PputGB1_4424)

MetaCyc: 78% identical to oxaloacetate decarboxylase monomer (Pseudomonas aeruginosa)
Malate dehydrogenase (oxaloacetate-decarboxylating). [EC: 1.1.1.38, 1.1.1.40, 1.1.1.83, 4.1.1.112]

Predicted SEED Role

"carboxyphosphonoenolpyruvate phosphonomutase, putative"

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• glyoxylate cycle (6/6 steps found)
• gluconeogenesis I (11/13 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• gluconeogenesis III (9/12 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (6/8 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• TCA cycle III (animals) (7/10 steps found)
• superpathway of vanillin and vanillate degradation (7/10 steps found)
• methylgallate degradation (4/6 steps found)
• chitin deacetylation (2/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• reductive TCA cycle I (7/11 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• L-carnitine degradation II (1/3 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (8/14 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• formaldehyde assimilation I (serine pathway) (7/13 steps found)
• syringate degradation (6/12 steps found)
• pyruvate fermentation to propanoate I (2/7 steps found)
• reductive TCA cycle II (5/12 steps found)
• methylaspartate cycle (10/19 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
• L-glutamate degradation VIII (to propanoate) (2/11 steps found)
• phosalacine biosynthesis (5/25 steps found)
• phosphinothricin tripeptide biosynthesis (5/25 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Carbon fixation in photosynthetic organisms
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.40, 2.7.8.23

Use Curated BLAST to search for 1.1.1.38 or 1.1.1.40 or 1.1.1.83 or 2.7.8.23 or 4.1.1.112

Sequence Analysis Tools

See Q88N27 at UniProt or InterPro

Protein Sequence (291 amino acids)

>PP_1389 Oxaloacetate decarboxylase (Pseudomonas putida KT2440)
MIMPKASHQDLRFAFRELLASGSCFHTASVFDPMSARIAADLGFEVGILGGSVASLQVLA
APDFALITLSEFVEQATRIGRVAQLPVLADADHGYGNALNVMRTVIELERAGVAALTIED
TLLPAQFGRKSTDLIPVEEGVGKIRAALEARVDSSLSIIARTNAGVLSTEEIIVRTQSYQ
KAGADGICMVGVKDFEQLEQIAEHLTVPLMLVTYGNPNLRDDERLARLGVRIVVDGHAAY
FAAIKATYDCLRLQRGRQNKSENLSATELSHTYTQPEDYIRWAKEYMSVEE