Protein Info for PP_1388 in Pseudomonas putida KT2440

Annotation: Drug resistance transporter, EmrB/QacA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 334 to 351 (18 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details amino acids 400 to 422 (23 residues), see Phobius details amino acids 456 to 475 (20 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 14 to 417 (404 residues), 235.7 bits, see alignment E=4.9e-74 PF07690: MFS_1" amino acids 17 to 409 (393 residues), 186.5 bits, see alignment E=1e-58 PF00083: Sugar_tr" amino acids 47 to 178 (132 residues), 48.5 bits, see alignment E=9.9e-17 PF06609: TRI12" amino acids 53 to 417 (365 residues), 50.4 bits, see alignment E=2e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1388)

Predicted SEED Role

"drug resistance transporter, EmrB/QacA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N28 at UniProt or InterPro

Protein Sequence (483 amino acids)

>PP_1388 Drug resistance transporter, EmrB/QacA family (Pseudomonas putida KT2440)
MTAALPPTALRNVLTALMLAIFLGALDQTIVAVSLPAISAQFSDVGLLAWVISGYMVAMT
VAVPIYGKLGDLYGRRRMILTGISLFTLASIACAMAQDMPQLVLARVLQGIGAGGMVSVS
QAIIGDFVPPRERGRYQGYFSSMYAAASVAGPVLGGWLTEYLSWRWVFWINLPLGLVALW
AIRRALADMPVQRREAQVDYLGAMLLILGLGSLLLGITLVGQGHAWADPAVLALFGCALL
GLALFIAHERRCPEPLLPLSLFGNRVAVLCWAVIFFASFQSISLTMLMPLRYQGITGAGA
DSAALHLLPLAMGLPMGAFTGGRMTSRTGRYKPQILAGALLMPVAIFAMALTPPQSALLS
ALFMLLTGIACGLQFPTSLVGTQSAVASKDIGVATSTTNLFRSLGGAMGVACMSSLLLAL
LHQGGFELSGNPLLGSLKAAEVDPGTQGRLLETFRQLLMGSAVVAVLGLLAALALPDRQL
RGR