Protein Info for PP_1379 in Pseudomonas putida KT2440

Annotation: 3-carboxy-cis,cis-muconate cycloisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 187 to 204 (18 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details TIGR02426: 3-carboxy-cis,cis-muconate cycloisomerase" amino acids 5 to 348 (344 residues), 493.2 bits, see alignment E=1.7e-152 PF00206: Lyase_1" amino acids 11 to 300 (290 residues), 276.7 bits, see alignment E=2.9e-86 PF10397: ADSL_C" amino acids 364 to 440 (77 residues), 64.4 bits, see alignment E=9.9e-22

Best Hits

Swiss-Prot: 95% identical to PCAB_PSEPU: 3-carboxy-cis,cis-muconate cycloisomerase (Fragment) (pcaB) from Pseudomonas putida

KEGG orthology group: K01857, 3-carboxy-cis,cis-muconate cycloisomerase [EC: 5.5.1.2] (inferred from 100% identity to ppf:Pput_4344)

MetaCyc: 95% identical to subunit of 3-carboxymuconate cycloisomerase (Pseudomonas putida)
3-carboxy-cis,cis-muconate cycloisomerase. [EC: 5.5.1.2]

Predicted SEED Role

"3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 5.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N37 at UniProt or InterPro

Protein Sequence (450 amino acids)

>PP_1379 3-carboxy-cis,cis-muconate cycloisomerase (Pseudomonas putida KT2440)
MSNQLFDAYFTAPAMREIFSDRGRLQGMLDFEAALARAEASAGLVPHSAVAAIEAACQAE
RYDVGALANAIATAGNSAIPLVKALGKVIATGVPEAERYVHLGATSQDAMDTGLVLQLRD
ALDLIEADLGKLADTLSQQALKHADTPLVGRTWLQHATPVTLGMKLAGVLGALTRHRQRL
QELRPRLLVLQFGGASGSLAALGSKAMPVAEALAEQLKLTLPEQPWHTQRDRLVEFASVL
GLVAGSLGKFGRDISLLMQTEAGEVFEPSAPGKGGSSTMPHKRNPVGAAVLIGAATRVPG
LLSTLFAAMPQEHERSLGLWHAEWETLPDICCLVSGALRQAQVIAEGMEVDAARMRRNLD
LTQGLVLAEAVSIVLAQRLGRDRAHHLLEQCCQRAVAEQRHLRAVLGDEPQVSAELSGEE
LDRLLDPAHYLGQARVWVARAVSEHQRFTA