Protein Info for PP_1375 in Pseudomonas putida KT2440

Annotation: transcription regulatory protein (pca regulon)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR02431: beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family" amino acids 42 to 289 (248 residues), 355.5 bits, see alignment E=6.7e-111 PF09339: HTH_IclR" amino acids 47 to 98 (52 residues), 57.7 bits, see alignment 7.9e-20 PF01614: IclR_C" amino acids 112 to 287 (176 residues), 193.9 bits, see alignment E=1.7e-61

Best Hits

Swiss-Prot: 97% identical to PCAR_PSEPU: Pca regulon regulatory protein (pcaR) from Pseudomonas putida

KEGG orthology group: K02624, IclR family transcriptional regulator, pca regulon regulatory protein (inferred from 100% identity to ppu:PP_1375)

Predicted SEED Role

"Pca regulon regulatory protein PcaR" in subsystem Protocatechuate branch of beta-ketoadipate pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N41 at UniProt or InterPro

Protein Sequence (291 amino acids)

>PP_1375 transcription regulatory protein (pca regulon) (Pseudomonas putida KT2440)
MSDETLGNDSGNAEVARPASAAMAPPIVASPAKRIQAFTGDPDFMTSLARGLAVIQAFQE
RKRHLTIAQISHRTEIPRAAVRRCLHTLIKLGYATTDGRTYSLLPKVLTLGHAYLSSTPL
AISAQPYLDRISDQLHEAANMATLEGDDILYIARSATVERLISVDLSVGGRLPAYCTSMG
RILLAAMDDTSLREYLERADLKARTSRTLNDPESLFACIQQVRAQGWCVVDQELEQGLRS
IAVPVYDASGQVLAALNVSTHVGRVTRSELEQRFLPILLAASRDLCHQLFG