Protein Info for PP_1371 in Pseudomonas putida KT2440

Annotation: Methyl-accepting chemotaxis protein PctA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details PF02743: dCache_1" amino acids 36 to 254 (219 residues), 86.9 bits, see alignment E=3.3e-28 PF22673: MCP-like_PDC_1" amino acids 96 to 174 (79 residues), 29.5 bits, see alignment E=1.8e-10 PF00672: HAMP" amino acids 290 to 343 (54 residues), 54.9 bits, see alignment 1.8e-18 PF00015: MCPsignal" amino acids 407 to 589 (183 residues), 143.9 bits, see alignment E=9.6e-46

Best Hits

Swiss-Prot: 100% identical to MCPG_PSEPK: Methyl-accepting chemotaxis protein McpG (mcpG) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to ppu:PP_1371)

Predicted SEED Role

"Chemotactic transducer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N45 at UniProt or InterPro

Protein Sequence (624 amino acids)

>PP_1371 Methyl-accepting chemotaxis protein PctA (Pseudomonas putida KT2440)
MNKSLRFSHKILLAASLIVILAFSLFTLYNDYLQRNAIREDLENYLAEMGASTSTNIRNL
FEGRIKLVENLAQNIAQDPANAETLMGQNALISSFLTVYLGKVDGGFSVRPDAKMPDGYD
PRTRPWYKDGMNASGATLTEPYIDMTTNKMVIGILSKVSSSVGVVGGDLALDGLVQIINS
LNFGGMGYAFLVNDQGKILVHPDKDLVMKSLSDLFPQHTPKLTGELTEVQSDGQTRLLTF
SPITGLPSANWYIGLSVDKDKAFSMLSTFRTSAVIATVVAVVIIIGLLGLLIRVLMQPLH
TMTRAMEDIAEGEGDLTKRLHIHSHDEFGVLGNAFNRFVERIHSSIREVSSATEQVNEVA
LRVISASNSSMTNSDEQSNRTNSVAAAINELGAAAQEIAGNAAQASQHASSARLLAEEGQ
QVVERNIAAMNRLSDLIVTSSAHIETLNSKTVNIGQILEVITSISQQTNLLALNAAIEAA
RAGEAGRGFAVVADEVRNLAHRTQESAQQVQTMIEELQVGARESVDTMEQSQRHSQDSMQ
IANQAGERLDSVTVRIGEIDGMNQSVATATEEQTAVVEAINMDINEINMLNQEGVENLQA
TLRACSDLEQQAGRLKHLVGSFRI