Protein Info for PP_1368 in Pseudomonas putida KT2440

Annotation: putative membrane protein containing a glycosyltransferase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 8 to 309 (302 residues), 201.2 bits, see alignment E=1.4e-63 TIGR00374: TIGR00374 family protein" amino acids 10 to 316 (307 residues), 95.1 bits, see alignment E=2.8e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1368)

Predicted SEED Role

"FIG00955324: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N48 at UniProt or InterPro

Protein Sequence (330 amino acids)

>PP_1368 putative membrane protein containing a glycosyltransferase domain (Pseudomonas putida KT2440)
MKRWAWLALALLGAALVPALLGGSELLPRLSRFDPHLLLMLLGMILLCWVINALRLRLLL
GEQAKQLSHARSLGVVMATEFAICTTPGGSGGPLTLMALLARDRIRPARSGAVFAMDQLN
DLVFFFCAMLAIAGYALFHSLGRSQESMLLGSALLLCSALAGVIGLLRYRRPIMRMNGRL
LQRMGMGQPRKRRWARKLLHFVAALAQTWRLPKRRLSLVFTLTCIHWGLRYSVLYLVLRG
LGVDLHWIPSFLVQMLSLSAGQFSLLPGGAGAAELTSASLLTPLVGSSTAAAAILIWRAV
TYYFYLLAGGPVFVCLLGRPLLERWRRQAG