Protein Info for PP_1354 in Pseudomonas putida KT2440

Annotation: putative multidrug efflux MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 227 to 251 (25 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details amino acids 320 to 339 (20 residues), see Phobius details amino acids 351 to 375 (25 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details PF00083: Sugar_tr" amino acids 10 to 192 (183 residues), 31.9 bits, see alignment E=6.8e-12 PF07690: MFS_1" amino acids 20 to 340 (321 residues), 129.3 bits, see alignment E=1.7e-41

Best Hits

KEGG orthology group: K08160, MFS transporter, DHA1 family, multidrug/chloramphenicol efflux transport protein (inferred from 100% identity to ppu:PP_1354)

Predicted SEED Role

"Bicyclomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N62 at UniProt or InterPro

Protein Sequence (414 amino acids)

>PP_1354 putative multidrug efflux MFS transporter (Pseudomonas putida KT2440)
MKPLLYITPLRALLFGLTLALFELLTYLASDAVMPAMPVVVSDLDASPEYIPHALNLYLL
GGVVLQWLIGPLADRYGRRPLLLVGCAFFGLACLATFWVQDIGLFNLLRLLQGIGLGFVV
TVSYPALNEAFSEADAVRMMALLANIALLSPLLGPLVGTLLLQWLDWRWLFVAFAIGAVL
TWLLLYRLMPETLGVERRDGSRLAFTPIHLLPLLAGYGQLLGNRRFVAGSAALGLVGLPL
IGWIGLSPVLLIHDEGLSTLEYALWQLPVFCGLILGNLIINRIADRYPLPALVRGALWPY
LAGLCLMVLATWYWPSVTSVVAGMSLYALGLGVANAVLYRMTLFSSEQSKGLVSAMLGMI
TIALLGFGGALLAMIGAGASLLHFALAAGVAGALALWPLWFVVGGRPGEGAVAR