Protein Info for PP_1352 in Pseudomonas putida KT2440

Annotation: UPF0234 protein PP_1352

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF04461: DUF520" amino acids 2 to 160 (159 residues), 213.2 bits, see alignment E=1.2e-67

Best Hits

Swiss-Prot: 100% identical to Y1352_PSEPK: UPF0234 protein PP_1352 (PP_1352) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K09767, hypothetical protein (inferred from 98% identity to ppg:PputGB1_4497)

Predicted SEED Role

"FIG001943: hypothetical protein YajQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P59560 at UniProt or InterPro

Protein Sequence (161 amino acids)

>PP_1352 UPF0234 protein PP_1352 (Pseudomonas putida KT2440)
MPSFDVVSELDKHEVQNAVDNAIKELDRRYDLKGKGTFEFKDKEQTVMLTAEEEFQLEAM
LEILRLALVKRKIDVKCLETKDPYASGKEKKQEAKFREGIDKDLAKKIVATIKDGKLKVQ
AAIQGEQVRVTGKKRDDLQEAIALLRTKEFDMPLQFNNFRD