Protein Info for PP_1338 in Pseudomonas putida KT2440

Annotation: UDP-N-acetylmuramate--L-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details TIGR01082: UDP-N-acetylmuramate--L-alanine ligase" amino acids 18 to 467 (450 residues), 570 bits, see alignment E=2.2e-175 PF01225: Mur_ligase" amino acids 18 to 116 (99 residues), 107.8 bits, see alignment E=4.5e-35 PF08245: Mur_ligase_M" amino acids 121 to 301 (181 residues), 98.7 bits, see alignment E=6.8e-32 PF02875: Mur_ligase_C" amino acids 323 to 458 (136 residues), 59.9 bits, see alignment E=7.3e-20

Best Hits

Swiss-Prot: 100% identical to MURC_PSEPK: UDP-N-acetylmuramate--L-alanine ligase (murC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 99% identity to pen:PSEEN4484)

MetaCyc: 62% identical to UDP-N-acetylmuramate--L-alanine ligase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramate--L-alanine ligase. [EC: 6.3.2.8]

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N75 at UniProt or InterPro

Protein Sequence (482 amino acids)

>PP_1338 UDP-N-acetylmuramate--L-alanine ligase (Pseudomonas putida KT2440)
MVESQKAMPQPKMGRIRRIHFVGIGGVGMCGIAEVLLNLGYEVSGSDLKASPVTERLESF
GAEIFVGHRAENAATADVLVVSSAINPANPEVATALERRIPVVPRAEMLAELMRYRHGVA
VAGTHGKTTTTSLLASVFAAGGLDPTFVIGGRLTAAGTNAQLGTSRYLIAEADESDASFL
HLQPMVAVVTNIDADHMATYEGDFNKLKKTFVEFLHNLPFYGLAVMCLDDPVVREILPQV
KRPTVTYGFSEEADIRAINVRQQGMQTHFTVLRRDREPLEVSVNMPGNHNVLNALATIAI
ATDEGITDEAIVQGLSGFQGVGRRFQVYGELPVEGGSVMLVDDYGHHPTEVAAVIKAVRG
GWPSRRLVIVYQPHRYSRTRDLYDDFVQVLGDANVLLLMEVYPAGEEPIPGADSRQLCHS
IRQRGKLDPIYIERGAELAPLVKPLLRAGDILLCQGAGDVGGLAPQLMKSPLFAGAKQEK
SK