Protein Info for PP_1336 in Pseudomonas putida KT2440

Annotation: lipid II flippase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 155 to 172 (18 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details TIGR02614: cell division protein FtsW" amino acids 24 to 379 (356 residues), 425.1 bits, see alignment E=1.1e-131 PF01098: FTSW_RODA_SPOVE" amino acids 27 to 381 (355 residues), 336.2 bits, see alignment E=1.1e-104

Best Hits

Swiss-Prot: 89% identical to FTSW_PSEFS: Probable peptidoglycan glycosyltransferase FtsW (ftsW) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03588, cell division protein FtsW (inferred from 100% identity to ppf:Pput_4388)

MetaCyc: 45% identical to peptidoglycan glycosyltransferase FtsW (Escherichia coli K-12 substr. MG1655)
Peptidoglycan glycosyltransferase. [EC: 2.4.1.129]

Predicted SEED Role

"Cell division protein FtsW" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.129

Use Curated BLAST to search for 2.4.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N77 at UniProt or InterPro

Protein Sequence (404 amino acids)

>PP_1336 lipid II flippase (Pseudomonas putida KT2440)
MIFGIFKPYPSPLISGRGIDLDFPMLAGCLALLGLGLVMITSASSEVAAVQSGNPLYHMF
RHLVYVFLGLVACGATMLVPIATWQRMGFMMLLGAFGLLVLVLVPGIGREVNGSMRWIGF
SFFNVQPSEIAKVFVVIYLAGYLVRRQTEVRETWMGFFKPFIVLLPMAALLLMEPDFGAT
VVMMGAAAAMLFLGGVGLFRFSLMVVLAVLAVFVLVQAQPYRMARLITFTDPWADQFGSG
YQLTQALIAFGRGEWLGVGLGNSVQKQFYLPEAHTDFVFSVLAEELGVVGSLLTVALFVF
VTVRALYIGLWAEKAKQFFAAYMAFGLAFLWIGQFLINIGVNVGLLPTKGLTLPFLSYGG
SSLVICCACVGLLLRIEWESRTHLGSEEHEFSESDFAEETSHGR