Protein Info for PP_1335 in Pseudomonas putida KT2440

Annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21799: MurD-like_N
  • amino acids 13 to 99 (87 residues), 94.4 bits, E=6.2e-31
• TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase
  • amino acids 14 to 445 (432 residues), 399.7 bits, E=9.6e-124
• PF08245: Mur_ligase_M
  • amino acids 116 to 287 (172 residues), 79.9 bits, E=3.8e-26
• PF02875: Mur_ligase_C
  • amino acids 310 to 426 (117 residues), 65.5 bits, E=1.3e-21

Best Hits

Swiss-Prot: 100% identical to MURD_PSEPK: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 100% identity to ppu:PP_1335)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

See Q88N78 at UniProt or InterPro

Protein Sequence (450 amino acids)

>PP_1335 UDP-N-acetylmuramoylalanine--D-glutamate ligase (Pseudomonas putida KT2440)
MSVSLIASDQFRIVVGLGKSGMSLVRFLASRGIAFAVADTREQPPELETLRRDYPQVEVR
CGELDVDFLCRANELYVSPGLALATPALQQAAARGVKLSGDIELFARHAKAPIVAISGSN
AKSTVTTLVGEMAAKAGKRVAVGGNLGTPALDLLADDIELYVLELSSFQLETTDQLNAEV
ATVLNISEDHMDRYSGLPAYHLAKHRIFRGARQVVVNRQDALSRPLPVEGRPCWTFGLNP
PDFKAFGLREVDGEKYLAFEFQTLMPARELKVRGAHNQSNALAALALGHAAGLPFEPMLE
ALREFGGLAHRCQWVRERNGVNWYDDSKATNVGAALAAIEGLGADIEGKLVLIAGGDGKG
AEFTALREPVKRFCRAVVLLGRDAERLAEALGDAVPLVRVKTLDDAVQQCAELAQAGDAV
LLSPACASLDMFKNFEERGRLFAQAAGGLA