Protein Info for PP_1330 in Pseudomonas putida KT2440

Annotation: Cell division protein FtsL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 97 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details transmembrane" amino acids 14 to 33 (20 residues), see Phobius details PF04999: FtsL" amino acids 1 to 96 (96 residues), 102.2 bits, see alignment E=6.1e-34 TIGR02209: cell division protein FtsL" amino acids 13 to 95 (83 residues), 85.3 bits, see alignment E=1e-28

Best Hits

Swiss-Prot: 77% identical to FTSL_PSEAE: Cell division protein FtsL (ftsL) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03586, cell division protein FtsL (inferred from 96% identity to pen:PSEEN4492)

Predicted SEED Role

"Cell division protein FtsL" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N83 at UniProt or InterPro

Protein Sequence (97 amino acids)

>PP_1330 Cell division protein FtsL (Pseudomonas putida KT2440)
MSRLLAKPLPGGSFLMLLLFVGVLVSAIAVSYSAHWNRQLLNTLYGELNERDKAQAEWGR
LILEQSTWTAASRIENLASEQLKMRVPSADEVRMVAP