Protein Info for PP_1328 in Pseudomonas putida KT2440

Annotation: Protein MraZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF02381: MraZ" amino acids 8 to 81 (74 residues), 59.2 bits, see alignment E=1.6e-20 amino acids 84 to 138 (55 residues), 55.3 bits, see alignment E=2.6e-19 TIGR00242: division/cell wall cluster transcriptional repressor MraZ" amino acids 8 to 154 (147 residues), 153.9 bits, see alignment E=1.4e-49

Best Hits

Swiss-Prot: 99% identical to MRAZ_PSEP1: Transcriptional regulator MraZ (mraZ) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K03925, MraZ protein (inferred from 100% identity to ppu:PP_1328)

Predicted SEED Role

"Cell division protein MraZ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N85 at UniProt or InterPro

Protein Sequence (157 amino acids)

>PP_1328 Protein MraZ (Pseudomonas putida KT2440)
MWGITAVFRGANAVSLDAKGRLAMPSRYRDELDSRCNGQLIVTIDAVDPCLCVYPLDEWE
QIEAKLRALPSLREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYAKLDKKAMLVGQL
NKFQLWDEDAWNAVSAADLAAIQQPGAMPDELRDLIL