Protein Info for PP_1324 in Pseudomonas putida KT2440

Annotation: putative endonuclease distantly related to archaeal Holliday junction resolvase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 TIGR00252: TIGR00252 family protein" amino acids 8 to 123 (116 residues), 116.6 bits, see alignment E=3.3e-38 PF02021: UPF0102" amino acids 14 to 104 (91 residues), 91.2 bits, see alignment E=2.2e-30

Best Hits

Swiss-Prot: 100% identical to Y1324_PSEPK: UPF0102 protein PP_1324 (PP_1324) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K07460, putative endonuclease (inferred from 100% identity to ppu:PP_1324)

Predicted SEED Role

"Predicted endonuclease distantly related to archaeal Holliday junction resolvase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N88 at UniProt or InterPro

Protein Sequence (124 amino acids)

>PP_1324 putative endonuclease distantly related to archaeal Holliday junction resolvase (Pseudomonas putida KT2440)
MMAAASPTRAGQAAETQALEYLQGQGLQLLARNWRCKGGELDLVMLDADTVVFVEVRYRL
HAGFGGALDSIDGRKQKRLVLAATLFLQKEAHWGNYPCRFDVVALQGSHHAGRPLQWLKN
AFEC