Protein Info for PP_1323 in Pseudomonas putida KT2440

Annotation: factor modulating bacterial replication archosome assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF13580: SIS_2" amino acids 12 to 144 (133 residues), 118.6 bits, see alignment E=2.2e-38 PF01380: SIS" amino acids 87 to 152 (66 residues), 26.5 bits, see alignment E=4.9e-10

Best Hits

Swiss-Prot: 100% identical to GMHA_PSEP1: Phosphoheptose isomerase (gmhA) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 98% identity to pen:PSEEN4498)

MetaCyc: 47% identical to D-sedoheptulose 7-phosphate isomerase (Aneurinibacillus thermoaerophilus)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.- or 5.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N89 at UniProt or InterPro

Protein Sequence (195 amino acids)

>PP_1323 factor modulating bacterial replication archosome assembly (Pseudomonas putida KT2440)
MQSRIRRLFEASIETKQQAMDILAPHIEQASLVMVNALLNEGKMLACGNGGSAGDAQHFS
SELLNRFERERPSLPAIALTTDSSTLTSIANDYSYNEVFSKQIRALGQPGDVLLAISTSG
NSANVIQAIQAAHDREMIVVALTGRDGGGMASLLLPEDVEIRVPSTVTARIQEVHLLAIH
CLCDLIDSQLFGSEE