Protein Info for PP_1317 in Pseudomonas putida KT2440

Annotation: Ubiquinol-cytochrome c reductase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF10399: UCR_Fe-S_N" amino acids 2 to 40 (39 residues), 39.5 bits, see alignment 3.1e-14 TIGR01416: ubiquinol-cytochrome c reductase, iron-sulfur subunit" amino acids 9 to 191 (183 residues), 228.1 bits, see alignment E=3.6e-72 PF00355: Rieske" amino acids 113 to 176 (64 residues), 24.7 bits, see alignment E=1.7e-09

Best Hits

Swiss-Prot: 56% identical to UCRI_ALLVD: Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K00411, ubiquinol-cytochrome c reductase iron-sulfur subunit [EC: 1.10.2.2] (inferred from 100% identity to ppf:Pput_4407)

MetaCyc: 43% identical to ubiquinol--cytochrome c reductase iron-sulfur subunit (Acidithiobacillus ferrooxidans)
RXN-15829 [EC: 7.1.1.8]

Predicted SEED Role

"Ubiquinol-cytochrome C reductase iron-sulfur subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2 or 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N95 at UniProt or InterPro

Protein Sequence (197 amino acids)

>PP_1317 Ubiquinol-cytochrome c reductase iron-sulfur subunit (Pseudomonas putida KT2440)
MSNDGVNAGRRRFLVAATSVVGAAGAVGAAVPFVGSWFPSAKAKAAGAPVKVNIAKVEAG
QQMVAEWRGQPVFIVRRTEEILGNLKKITGDLSDPESKASVQPAYVDPEVRSIKPEILIL
VGLCTHLGCSPTFRPEVAPADLGPKWVGGYFCPCHGSHYDLAGRVYKSQPAPLNLPVPPH
SYESDEIIVIGVDQENA