Protein Info for PP_1295 in Pseudomonas putida KT2440

Annotation: ATP-dependent RNA helicase RhlB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 PF00270: DEAD" amino acids 115 to 290 (176 residues), 161.7 bits, see alignment E=2e-51 PF04851: ResIII" amino acids 135 to 285 (151 residues), 33.4 bits, see alignment E=6.3e-12 PF00271: Helicase_C" amino acids 326 to 434 (109 residues), 108.2 bits, see alignment E=4.1e-35

Best Hits

Swiss-Prot: 100% identical to RHLB_PSEPK: ATP-dependent RNA helicase RhlB (rhlB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03732, ATP-dependent RNA helicase RhlB [EC: 3.6.4.13] (inferred from 100% identity to ppu:PP_1295)

MetaCyc: 45% identical to ATP-dependent RNA helicase RhlB (Escherichia coli K-12 substr. MG1655)
5.6.2.e [EC: 5.6.2.e]

Predicted SEED Role

"ATP-dependent RNA helicase RhlB" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13 or 5.6.2.e

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NB7 at UniProt or InterPro

Protein Sequence (480 amino acids)

>PP_1295 ATP-dependent RNA helicase RhlB (Pseudomonas putida KT2440)
MLKALRKIFGKGEAAPQAAAPAASVTPEARPAAKPAAPHANPAPKAEQPAAATPPADQPA
KDKPRRERKPKPQASLWKPEDFVVEPQEGKTRFHDFKLSNELMHAIHDLGFPYCTPIQAQ
VLGYTLRGQDAIGRAQTGTGKTAAFLISIISQLQQTPPPKERYMGEPRALIIAPTRELVV
QIAKDAAALTKYTGLNVMSFVGGMDFDKQLKALEARHCDILVATPGRLLDFNQRGEVHLD
MVEVMVLDEADRMLDMGFIPQVRQIIRQTPPKSERQTLLFSATFTDDVMNLAKQWTTNPA
IVEIEPENVASETVEQHVYAVAGSDKYKLLYNLVTQNKWERVMVFANRKDEVRRIEEKLV
RDGINAAQLSGDVPQHKRIRTLESFREGRITVLVATDVAGRGIHIDGISHVINFTLPEDP
DDYVHRIGRTGRAGTSGVSISFAGEDDSYQLPAIEALLGRKIKCEMPPDELLKPVPRKHH