Protein Info for PP_1293 in Pseudomonas putida KT2440

Annotation: molybdopterin synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 82 TIGR01687: MoaD family protein" amino acids 4 to 82 (79 residues), 49.6 bits, see alignment E=4.4e-17 TIGR01682: molybdopterin converting factor, subunit 1" amino acids 4 to 82 (79 residues), 67.5 bits, see alignment E=1.5e-22 PF02597: ThiS" amino acids 6 to 82 (77 residues), 68 bits, see alignment E=4.3e-23

Best Hits

Swiss-Prot: 45% identical to MOAD_ECOLI: Molybdopterin synthase sulfur carrier subunit (moaD) from Escherichia coli (strain K12)

KEGG orthology group: K03636, molybdopterin synthase sulfur carrier subunit (inferred from 100% identity to ppf:Pput_4432)

MetaCyc: 45% identical to molybdopterin synthase sulfur carrier subunit (Escherichia coli K-12 substr. MG1655)
RXN-8342 [EC: 2.8.1.12]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaD" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NB9 at UniProt or InterPro

Protein Sequence (82 amino acids)

>PP_1293 molybdopterin synthase small subunit (Pseudomonas putida KT2440)
MMKVKVMYFARYRELLGVDAERVEGAFKVLDDVRQALVAKGGQYEVLAEQNLMCARNEEL
CKLDEPLEEGDEVAFFPPVTGG