Protein Info for PP_1286 in Pseudomonas putida KT2440

Annotation: Alginate biosynthesis protein Alg44

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 158 to 180 (23 residues), see Phobius details PF07238: PilZ" amino acids 16 to 114 (99 residues), 50.8 bits, see alignment E=3.7e-17 PF25964: BSH_ALG44" amino acids 200 to 293 (94 residues), 123.5 bits, see alignment E=5.7e-40 PF25891: Hl_ALG44" amino acids 231 to 257 (27 residues), 58.1 bits, see alignment (E = 1.3e-19) PF25965: Beta-barrel_ALG44" amino acids 297 to 376 (80 residues), 120 bits, see alignment E=7.6e-39

Best Hits

Swiss-Prot: 100% identical to ALG44_PSEPK: Alginate biosynthesis protein Alg44 (alg44) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1286)

MetaCyc: 57% identical to mannuronosyl transferase regulatory subunit (Pseudomonas aeruginosa)
Alginate synthase. [EC: 2.4.1.33]

Predicted SEED Role

"Alginate biosynthesis protein Alg44"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NC6 at UniProt or InterPro

Protein Sequence (388 amino acids)

>PP_1286 Alginate biosynthesis protein Alg44 (Pseudomonas putida KT2440)
MNTAVNVNVVHESEAQRQHARVRIPAKLRFLDAQRQVHEVKVEDLSAGGLSFHTKQPQSV
GDVLRGRLQFVVDNLGLSIDIEFQVRSYNPDNGRIGAQFQNLEPRDIATLRHIITSHLSG
ELISIGDVLSTLQRDNFTKARKQKDGGSGLSAFGRFKAVTVTLGVFVVGVAAFGFVAKSL
YGMYFVSHAEAGVVAVPTTNVTMPRDGTVSSLVESGGQIAKGAPLASFTTSMLDMLKGNL
EDAQLEPAKIEELFGKQLSGTLTSPCDCVVARQLVDDGQYAAKGQPIFQLIPRTTTPMVE
ARFSYRQFDEVKPGTRVNFQVAGEDEVRTGQIVSSASLNSEDLSSDIRVQIKPDTGLPAE
LAGRPASVNSDRGPSLNWLIDKAVARGL