Protein Info for PP_1267 in Pseudomonas putida KT2440

Annotation: toxin endoribonuclease of toxin antitoxin system SohB(PrlF)-YhaV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF11663: Toxin_YhaV" amino acids 17 to 152 (136 residues), 204.1 bits, see alignment E=4.5e-65

Best Hits

Swiss-Prot: 44% identical to YHAV_ECOL6: Toxin YhaV (yhaV) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1267)

MetaCyc: 43% identical to ribosome-dependent mRNA interferase toxin YhaV (Escherichia coli K-12 substr. MG1655)
Physarum polycephalum ribonuclease. [EC: 3.1.26.1]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NE5 at UniProt or InterPro

Protein Sequence (155 amino acids)

>PP_1267 toxin endoribonuclease of toxin antitoxin system SohB(PrlF)-YhaV (Pseudomonas putida KT2440)
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLA
FDVIPQDPTKPEYRQGATLGGDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWINDESSKR
AYESSDDAYKVFQKMLHSGNPPDDWDQLLQEAAAD