Protein Info for PP_1255 in Pseudomonas putida KT2440

Annotation: putative cis-4-hydroxy-D-proline oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF01266: DAO" amino acids 8 to 397 (390 residues), 206 bits, see alignment E=3e-64 PF00890: FAD_binding_2" amino acids 8 to 48 (41 residues), 24 bits, see alignment 5.3e-09 PF00070: Pyr_redox" amino acids 9 to 39 (31 residues), 23.6 bits, see alignment (E = 1.5e-08) PF02558: ApbA" amino acids 9 to 39 (31 residues), 23.6 bits, see alignment (E = 8.6e-09) PF13450: NAD_binding_8" amino acids 11 to 39 (29 residues), 28.1 bits, see alignment (E = 5.1e-10)

Best Hits

KEGG orthology group: K00285, D-amino-acid dehydrogenase [EC: 1.4.99.1] (inferred from 100% identity to ppu:PP_1255)

MetaCyc: 100% identical to D-hydroxyproline dehydrogenase subunit (Pseudomonas putida KT2442)
1.14.19.-

Predicted SEED Role

"D-amino acid dehydrogenase (EC 1.4.99.1) family protein in hydroxy-L-proline catabolic cluster" in subsystem Proline, 4-hydroxyproline uptake and utilization or Respiratory dehydrogenases 1 (EC 1.4.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.99.1

Use Curated BLAST to search for 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NF6 at UniProt or InterPro

Protein Sequence (415 amino acids)

>PP_1255 putative cis-4-hydroxy-D-proline oxidase (Pseudomonas putida KT2440)
MVETAETDIAVVGAGIVGVACALQLARQGHRVTLVDRQAPGLGASFGNAGHLATEQVFPI
ADLSILKRLPRMLLDPMGPLRLDWKYLPKAMPWFTRLLLNLRPAPFQRSVAGIRTLNEGS
LGAWQRLLGSIGRSELFQEDGSLLVFEKPESRQALEALRTRMQQQAVPVDFWSAETVREA
APQLSPSLLGGLFFPRTGHFIDPYRVVCELFEAAKASGVRFVQAQVDGGQLHSAGVSLAS
DQGMLNARQVLVSCGAHSAKLTAALTGKRVPLDTERGYHLMLPGEHQRLPFAVTSLERKF
IMTPMAEGLRLAGTVEFAGLQAPPSMQRAWQLHRLSKGLFRHDLSVEGATPWMGFRPSLP
DSLPVIDRVCDGRVLLAFGHQHLGLTQAAVTAEWVGRLAEQTGGPEMGAYRLNRF