Protein Info for PP_1248 in Pseudomonas putida KT2440

Annotation: Transporter, LysE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 57 to 79 (23 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details PF01810: LysE" amino acids 65 to 253 (189 residues), 111 bits, see alignment E=2.7e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1248)

Predicted SEED Role

"Threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NG1 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PP_1248 Transporter, LysE family (Pseudomonas putida KT2440)
MAAESYRLQALDPSRAWHRFFATVQQQVEKRAFGDDSSEHCLRNAQQELTMLGVTDYGAF
VIAFLILLAIPGPGNFALITATGKGGIKAGLAATCGVIVGDQVLLWLAVAGVATLLATYP
AAFHMVQWAGAAYLAYLGLRMLLSKPGGAAHTCRMDNGQYLRQTMMITLLNPKAIMFYMA
FFPLFVDPVKHQGLVTFGFMAATVAVVTFLYGLIAVVLTHQLAERMRASPRIANMFERLA
GACLVGFGIKLAAMR