Protein Info for PP_1240 in Pseudomonas putida KT2440

Annotation: Phosphoribosylaminoimidazole-succinocarboxamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 TIGR00081: phosphoribosylaminoimidazolesuccinocarboxamide synthase" amino acids 3 to 233 (231 residues), 261.9 bits, see alignment E=3.7e-82 PF01259: SAICAR_synt" amino acids 7 to 231 (225 residues), 279.6 bits, see alignment E=1.2e-87

Best Hits

Swiss-Prot: 100% identical to PUR7_PSEP1: Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 99% identity to ppg:PputGB1_4178)

MetaCyc: 72% identical to phosphoribosylaminoimidazole-succinocarboxamide synthase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylaminoimidazolesuccinocarboxamide synthase. [EC: 6.3.2.6]

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NG9 at UniProt or InterPro

Protein Sequence (236 amino acids)

>PP_1240 Phosphoribosylaminoimidazole-succinocarboxamide synthase (Pseudomonas putida KT2440)
MEKREELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGMVNNKFNAFIMQK
LEEAGVPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGVEEGIKLEPSTFEL
FLKNDEKGDPFINESHVVAFGWGTAEQLVEMKKLSLKVNEVLSKLFDDAGLLLVDFKLEF
GVFHGQIVLGDEFSPDGCRLWDKETRKKMDKDRFRQGLGDVIEAYEEVAKRLGVPL