Protein Info for PP_1239 in Pseudomonas putida KT2440

Annotation: Metallo-beta-lactamase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00753: Lactamase_B" amino acids 9 to 88 (80 residues), 60.8 bits, see alignment E=2.6e-20 PF23023: Anti-Pycsar_Apyc1" amino acids 13 to 66 (54 residues), 35.3 bits, see alignment E=1.6e-12 PF12706: Lactamase_B_2" amino acids 24 to 211 (188 residues), 85.4 bits, see alignment E=6.3e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1239)

Predicted SEED Role

"Metal-dependent hydrolases of the beta-lactamase superfamily I" in subsystem Beta-lactamase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NH0 at UniProt or InterPro

Protein Sequence (252 amino acids)

>PP_1239 Metallo-beta-lactamase family protein (Pseudomonas putida KT2440)
MRFAVLGSGSQGNGTLIASGDTFILVDCGFSLRETERRLALLGVSAAQLSAVLVTHEHAD
HVHGVGLLSRRYNVPVYLSQGTLRGMRKPVEVAGFLACGQSLHIGSLEVTAARVEHDAYE
PLQYVVSDGKRRFGMLTDLGSYDALLLERYQGLDALLIEANHCRDLLARGHYPAFLKQRV
GGMQGHLNNHQAARLVHELGWNNLQHLVLAHLSSKNNLPHLARQCFVDTLGCDPDWLQVA
NQEHGLDWREIA