Protein Info for PP_1228 in Pseudomonas putida KT2440

Annotation: Methyl-accepting chemotaxis transducer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 335 to 355 (21 residues), see Phobius details PF22673: MCP-like_PDC_1" amino acids 109 to 241 (133 residues), 39.3 bits, see alignment E=1.2e-13 PF00672: HAMP" amino acids 354 to 407 (54 residues), 36.2 bits, see alignment 9.2e-13 PF00015: MCPsignal" amino acids 500 to 655 (156 residues), 148.5 bits, see alignment E=2.7e-47

Best Hits

Swiss-Prot: 100% identical to MCPU_PSEPK: Methyl-accepting chemotaxis protein McpU (mcpU) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to ppu:PP_1228)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NI1 at UniProt or InterPro

Protein Sequence (688 amino acids)

>PP_1228 Methyl-accepting chemotaxis transducer (Pseudomonas putida KT2440)
MPLRRLSIQWKITLLAGLCLLAIVALLVATSLTQAHRSAALVNQANTAMLEDSARQRLQA
HAETQALRIQRYFMDAYQYGNGFARLVQVLKDRGGSDLRAELTRQARASLAGNPDVIGLY
LVFQPNALDQQDSHYLGQDAMGSNESGRFSLYWSQPSPGTLELEAMPETMLGDTSIGSNG
AAKNRWLTCPQDTARTCMLEPYLDEVNGRQVLMTSIALPLLEHGKVVGVVGLDIGLANLQ
QLSVNGRRDLFDGQGQVSIATAAGLLAGNSRDDSVLGKPMDKSVADGLLRVAHPFTPIPD
TAPWQVVLELPESVLQAPAVALNQRLDAHNQNANLTSLLIGLGTAIAGLLLVWLTARGVT
RPILAVAARLEDIASGEGDLTRRLDYAHQDELGQLTGWFNRFLDKLQPVIAQVKGSLQEA
RNTADQSAAIASQTSDGMQQQHREIEQVATAANEMSATALDVAHNASQAAQAARAADQAS
QEGLQLVDSTRQGIDRLAAGMNTAMDEARALEDRSGQIGSVLEVIRTIAEQTNLLALNAA
IEAARAGEAGRGFAVVADEVRGLAQRTQVSVEEIRQVIEGLQQGTQDVVGAMHAGQRQAQ
DSAARMEQALPALQRIGEAVAVISDMNLQIASAAEEQSAVAEEVNRNVAGIRDVTESLAG
QADESARISQALNRLANQQQALMEQFRV