Protein Info for PP_1226 in Pseudomonas putida KT2440

Annotation: pre-queuosine 0 synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF06508: QueC" amino acids 5 to 215 (211 residues), 275.6 bits, see alignment E=2.5e-86 PF00733: Asn_synthase" amino acids 5 to 63 (59 residues), 36.8 bits, see alignment E=3.8e-13 TIGR00364: queuosine biosynthesis protein QueC" amino acids 6 to 208 (203 residues), 210 bits, see alignment E=1.3e-66

Best Hits

Swiss-Prot: 100% identical to QUEC_PSEPK: 7-cyano-7-deazaguanine synthase (queC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 98% identity to ppg:PputGB1_4192)

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NI3 at UniProt or InterPro

Protein Sequence (224 amino acids)

>PP_1226 pre-queuosine 0 synthase (Pseudomonas putida KT2440)
MTEKRAVILLSGGLDSATVVAMAKAEGYSCYTMSFDYGQRHRAELNAAARVARDLGVVEH
KVIGLNLDGIGGSALTDSSIDVPEAPGEGIPVTYVPARNTVFLSLALGWAEVLEARDIFI
GVNAVDYSGYPDCRPEFVEAFERMANLATKAGVEGQGFRIQAPLQNMSKAQIVQAGMARG
VDYSLTVSCYQADDDGRACGKCDSCRLRADGFKAAGIEDPTRYF