Protein Info for PP_1224 in Pseudomonas putida KT2440

Annotation: periplasmic subunit of the TolQRA transport system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 54 to 111 (58 residues), 32.1 bits, see alignment E=3.7e-11 TIGR02795: tol-pal system protein YbgF" amino acids 148 to 265 (118 residues), 141.7 bits, see alignment E=8e-46 PF13525: YfiO" amino acids 149 to 230 (82 residues), 26.9 bits, see alignment E=1.4e-09 PF13174: TPR_6" amino acids 152 to 181 (30 residues), 18.7 bits, see alignment (E = 7.6e-07) amino acids 187 to 217 (31 residues), 19.7 bits, see alignment 3.6e-07 amino acids 223 to 254 (32 residues), 21.4 bits, see alignment 1e-07 PF09976: TPR_21" amino acids 152 to 248 (97 residues), 27 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 100% identical to CPOB_PSEPU: Cell division coordinator CpoB (cpoB) from Pseudomonas putida

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_1253)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A130 at UniProt or InterPro

Protein Sequence (268 amino acids)

>PP_1224 periplasmic subunit of the TolQRA transport system (Pseudomonas putida KT2440)
MRMCRRVVTVLALSLPLAAWAEVPVVDDNAGSYPPAGYGTSGAYAGSGASAPASAQGQLF
MQLQQMQDQLSRQQGIIEELQNDVSRMKQENLERYQDLDRRINSGAAPAATPDNSSGGGA
SNAAPDAAAGAAAQQPAGSSQPGDPAKEKLYYDAAFDLIKQKDFDKASQAFNAFLRKYPN
SQYAGNAQYWLGEVNLAKGDLQGASQAFAQVSQKYPKHSKVPDSLYKLADVERRMGHTDK
VKGILQQVVTQYPGTSAAQLAQRDLQKL