Protein Info for PP_1220 in Pseudomonas putida KT2440

Annotation: subunit of a proton-driven complex used for maintenance of outer membrane stability

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details PF02472: ExbD" amino acids 8 to 148 (141 residues), 89.8 bits, see alignment E=8e-30 TIGR02801: protein TolR" amino acids 11 to 148 (138 residues), 143.8 bits, see alignment E=2.3e-46

Best Hits

Swiss-Prot: 82% identical to TOLR_PSEAE: Tol-Pal system protein TolR (tolR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03560, biopolymer transport protein TolR (inferred from 100% identity to ppf:Pput_1249)

Predicted SEED Role

"Tol biopolymer transport system, TolR protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NI7 at UniProt or InterPro

Protein Sequence (150 amino acids)

>PP_1220 subunit of a proton-driven complex used for maintenance of outer membrane stability (Pseudomonas putida KT2440)
MARVRHKRKPVAEMNVVPYIDVMLVLLVIFMVTAPMLNQGVKVDLPKVSSEALPQDNNVQ
ILTISIKADKTYYWNLGSEVDTDKQMDKAMTLPAMTDAVTKIIAAGRDQGKQTQVFIRGD
KAVDYGAVMGAMGGLQKAGVGNVGLITEAP