Protein Info for PP_1200 in Pseudomonas putida KT2440

Annotation: Probable potassium transport system protein kup

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 219 to 244 (26 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 299 to 323 (25 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 377 to 403 (27 residues), see Phobius details amino acids 409 to 427 (19 residues), see Phobius details amino acids 433 to 451 (19 residues), see Phobius details PF02705: K_trans" amino acids 25 to 476 (452 residues), 613 bits, see alignment E=2.8e-188 PF22776: K_trans_C" amino acids 489 to 636 (148 residues), 176.9 bits, see alignment E=2.4e-56

Best Hits

Swiss-Prot: 100% identical to KUP_PSEPK: Probable potassium transport system protein kup (kup) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03549, KUP system potassium uptake protein (inferred from 100% identity to ppu:PP_1200)

MetaCyc: 51% identical to K+:H+ symporter Kup (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-3

Predicted SEED Role

"Kup system potassium uptake protein" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NK7 at UniProt or InterPro

Protein Sequence (636 amino acids)

>PP_1200 Probable potassium transport system protein kup (Pseudomonas putida KT2440)
MVQASSHAESGHEGKQGASRSVGLLVAAVGVVYGDIGTSPLYTLKEVFTGGYGVSVNHDG
VLGILSLILWSLLWVVSFKYVMFILRADNQGEGGTMALTALARRATAAYPRLRTLMVICG
LIGASLFYGDSMITPAVSVLSAVEGVGLAFDGIDHWVVPISLVVLVALFLVQRHGTEKIG
KLFGPIMVTWFLALGALGVHGISQSPEVLKAFNPAWAVNFFVVHPGIGVAILGAVVLALT
GAEALYADMGHFGRKPIARAWFILVLPALVLNYFGQGALLLQNPEAARNPFYLLAPGWAL
LPLVGLATMATVIASQAVISGAFSLTRQAIQLGYIPRMQIQHTSSDEQGQIYIGAVNWTL
MVGVVLLVIGFESSGALAAAYGVAVTGTMLITTVLVSAVMLLLWKWPPLLAVPILVGFLL
VDGLFFAANVPKIAQGGAFPVLAGGVLYLLMSTWKRGKQILVERIDEGALPLPLFISSIR
IQPPHRVEGTAVFLTARSDAVPHALLHNMLHNQVLHSQVVLLTVVSEDRPRVPEHERFEV
EAYGDGFFRVLLHFGFMDEPDVPAALKLCHLDGLDFTPMRTTYFLSRETVIASRLEGMSR
WRGNLFAFLLKNANGNLRFFNLPLNRVIELGTQVEI