Protein Info for PP_1197 in Pseudomonas putida KT2440

Annotation: ribosomal protein S12 methylthiotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 9 to 440 (432 residues), 339.7 bits, see alignment E=2.4e-105 PF00919: UPF0004" amino acids 9 to 88 (80 residues), 73 bits, see alignment E=2.6e-24 TIGR01125: ribosomal protein S12 methylthiotransferase RimO" amino acids 9 to 439 (431 residues), 580.3 bits, see alignment E=2.7e-178 PF04055: Radical_SAM" amino acids 146 to 324 (179 residues), 84.7 bits, see alignment E=1.3e-27 PF18693: TRAM_2" amino acids 381 to 443 (63 residues), 75.9 bits, see alignment E=3.2e-25

Best Hits

Swiss-Prot: 100% identical to RIMO_PSEP1: Ribosomal protein S12 methylthiotransferase RimO (rimO) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K14441, ribosomal protein S12 methylthiotransferase [EC: 2.-.-.-] (inferred from 100% identity to ppu:PP_1197)

MetaCyc: 72% identical to ribosomal protein S12 methylthiotransferase RimO (Escherichia coli K-12 substr. MG1655)
RXN0-6366 [EC: 2.8.4.4]

Predicted SEED Role

"Ribosomal protein S12p Asp88 (E. coli) methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NL0 at UniProt or InterPro

Protein Sequence (443 amino acids)

>PP_1197 ribosomal protein S12 methylthiotransferase (Pseudomonas putida KT2440)
MSTTPATPKVGFVSLGCPKALVDSERILTQLRMEGYEVVPTYEDADVVVVNTCGFIDSAK
AESLEVIGEAIKENGKVIVTGCMGVEEGSIRDVHPSVLSVTGPQQYEQVVNAVHEVVPPR
QDHNPLIDLVPPQGVKLTPRHYAYLKISEGCNHSCSFCIIPSMRGKLVSRPVGEVLSEAE
RLVKAGVKEILVISQDTSAYGVDVKYKTDFWNGRPVKTRMLELCEALSSLGAWVRLHYVY
PYPNVDDVIPLMAAGKILPYLDIPFQHASPKVLKSMKRPAFEDRTLARIKNWREQCPELV
IRSTFIVGFPGETEEDFQYLLDWLTEAQLDRVGCFQYSPVEGAPANDLGLAEVPDDVKQE
RWDRFMAHQQAISAARLQLRIGKEIDVLIDEVEEQGSVGRSFFDAPEIDGSVFIDGDHGF
KPGDKVRCRVVDADEYDMWAEPI