Protein Info for PP_1171 in Pseudomonas putida KT2440

Updated annotation (from data): Uronate dehydrogenase (EC 1.1.1.203)
Rationale: Specifically important for utilizing D-Glucuronic Acid. Automated validation from mutant phenotype: the predicted function (1.1.1.203) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: uronate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01370: Epimerase" amino acids 10 to 168 (159 residues), 77.8 bits, see alignment E=2.3e-25 PF01073: 3Beta_HSD" amino acids 12 to 131 (120 residues), 40.5 bits, see alignment E=4.4e-14 PF13460: NAD_binding_10" amino acids 13 to 116 (104 residues), 35.2 bits, see alignment E=2.9e-12 PF16363: GDP_Man_Dehyd" amino acids 47 to 166 (120 residues), 47.5 bits, see alignment E=4.6e-16 PF07993: NAD_binding_4" amino acids 59 to 175 (117 residues), 25.2 bits, see alignment E=2.2e-09

Best Hits

Swiss-Prot: 100% identical to URODH_PSEPK: Uronate dehydrogenase (udh) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1171)

MetaCyc: 78% identical to uronic acid dehydrogenase subunit (Pseudomonas syringae)
Uronate dehydrogenase. [EC: 1.1.1.203]; 1.1.1.203 [EC: 1.1.1.203]

Predicted SEED Role

"Uronate dehydrogenase (EC 1.1.1.203)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.203)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.203

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NN6 at UniProt or InterPro

Protein Sequence (268 amino acids)

>PP_1171 Uronate dehydrogenase (EC 1.1.1.203) (Pseudomonas putida KT2440)
MTTTPFNRLLLTGAAGGLGKVLRERLKGYAEVLRLSDISPMAPAAGPHEEVITCDLADKA
AVHTLVEGVDAIIHFGGVSTEHAFEEILGPNICGVFHVYEAARKHGVKRIIFASSNHTIG
FYRQDERIDAHAPRRPDSYYGLSKCYGEDVASFYFDRYGIETVSIRIGSSFPQPQNLRML
CTWLSYDDLVQLIERGLFTPGVGHTIVYGASDNRTVWWDNRHAAHLGYVPKDSSETFRAA
VEAQPAPAADDPSMVYQGGAFAVAGPFN