Protein Info for PP_1166 in Pseudomonas putida KT2440

Annotation: putative permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 44 to 65 (22 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 262 to 279 (18 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details PF00892: EamA" amino acids 16 to 147 (132 residues), 37.8 bits, see alignment E=1.1e-13 amino acids 167 to 302 (136 residues), 39.9 bits, see alignment E=2.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1166)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NP1 at UniProt or InterPro

Protein Sequence (307 amino acids)

>PP_1166 putative permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas putida KT2440)
MAVPSSAVPLFPRKLAIALLALLACSFAGNHIAARIAFDDGTGVLLAILCRSGITFLVLA
GLLLWQRQALALPAGARRWQLLLGLLIATQSLCLYSAVARIPVALALLVGNTFPMLLALL
TWALGGARPTGRTVLFMGLILCGLVLALDVPARLADSGAANPHWVPGVSLAFGAACAFAC
ALWITDHKLASVRGPVRSLLTLLIVFSSMLVAGASGVMPSGLSLPGSSGGWAALASLVVL
YGLAFTLLFVCVPRLNMAQNAPVMNVEPIATLLLGWALLDQQLGTLQLLGGAVVVCGIVL
LTYRRAN