Protein Info for PP_1159 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 67 to 84 (18 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 358 to 380 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1159)

Predicted SEED Role

"FIG00960888: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NP8 at UniProt or InterPro

Protein Sequence (384 amino acids)

>PP_1159 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MNTLFFSRQQYWLALIFGCLLVFLAASLGHGQWLDYAQRVATLDEPLSRLRWIVGDISEV
AFYKHELPALGLLLGACLAHWAQLRGYRWQGFAICYGSGLWPWVFTSSLLGLLLSHVLWG
WTLASGTWQPTFVAFVSLPAAMVLLFGAGWRVTITGALLGALLVTPAGLLMVNYLCYPLQ
LPVVVGNVSGMAVASVVAFILCKRFPSWVRQCGEPTVVAPVVNQPDYGVVWTLRRVLADF
SEAPFFGNELASLGLLLGVLLAYLLSPAALSYGSMLVMQMVAGQALASLVGVVLWRGQWK
ARGWYPTYIPIVSIVPAAVLTHGGSWQVVVASAVLGALVAPPLAVAITQRLPAYVHGYIG
NVVSMAICTLGIVPVVGLLVGGEA