Protein Info for PP_1156 in Pseudomonas putida KT2440

Annotation: putative inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 49 to 73 (25 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 32 to 268 (237 residues), 174.9 bits, see alignment E=9.3e-56

Best Hits

Swiss-Prot: 60% identical to YFDC_ECOLI: Inner membrane protein YfdC (yfdC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1156)

Predicted SEED Role

"Putative transport"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NP9 at UniProt or InterPro

Protein Sequence (298 amino acids)

>PP_1156 putative inner membrane protein (Pseudomonas putida KT2440)
MSNGQSEKTPGLSADEEQEVSHSQPPRAAVLHEIIRYQGDQELERTLAALWWSALAAGLS
MGLSLMAMGLFYARLPEGAGAQVVASIGYSAGFLAVILARQQLFTENTLTAVLPVMTAPT
LANFGRLLRLWGVVLLGNLAGTLLVAWVMLELPIFDSKTDVAFLEVGRKVMKNDISQMFA
KGIVSGWMIATMVWMIPSMEHAKIWIILMITYLMALGDFTHIVVGSVEVSYLVWAGDETW
SRFWLEFALPTLAGNIIGGSFIFALISHAQVRSDSGKPPSRLLNEDQPRSARSRHEHK