Protein Info for PP_1154 in Pseudomonas putida KT2440

Annotation: Sensory box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 861 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details PF05228: CHASE4" amino acids 62 to 216 (155 residues), 52.8 bits, see alignment E=1.4e-17 TIGR00229: PAS domain S-box protein" amino acids 303 to 426 (124 residues), 45.2 bits, see alignment E=1e-15 PF13188: PAS_8" amino acids 307 to 358 (52 residues), 27.8 bits, see alignment 5.3e-10 PF00989: PAS" amino acids 308 to 418 (111 residues), 25.5 bits, see alignment E=3.4e-09 PF08448: PAS_4" amino acids 314 to 422 (109 residues), 29 bits, see alignment E=3.2e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 428 to 590 (163 residues), 145.1 bits, see alignment E=1.6e-46 PF00990: GGDEF" amino acids 433 to 587 (155 residues), 161.5 bits, see alignment E=4.4e-51 PF00563: EAL" amino acids 608 to 840 (233 residues), 232.4 bits, see alignment E=1.5e-72

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1154)

Predicted SEED Role

"sensory box protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NQ1 at UniProt or InterPro

Protein Sequence (861 amino acids)

>PP_1154 Sensory box protein (Pseudomonas putida KT2440)
MARTAKLSPASPTPRFQVRHLIAGFSAVFGLACLVILGALFNIARTLDQQERERSAFHAT
QALEQRLLASRQFLSSYAVWDAAFEHLSGQADWQWAYEEKNVGESLYSASGYEGVFVVEN
RRTTYALFKGQPSQAGADSYIDTPLQPIIEQARAAAISREQVTRFVLFNGWPAALSAAAV
RPDREVTDSEVSQAPVMLFIDQLTESKLAQLGKGAGLTGMHVEKEDRQDHNHLRIDLGDT
GYHLTWNSPLPGQQMLWAVLPALLCALLILGLVMLYLFRHALRSSRAIGLTLVHLQQSNQ
ALEASEQRFRAVAESASDWIWETDRQQRLTYLSQRFANVTGYPVDGWLGHPLNQLLACDT
TPLSPWLDALTAAEPQQLANLRCTYRDQNGQNRYCRISARAIWRDGKAIGFRGTASDITD
EVDAHARIQHLSLHDPLTGLANRNKLARHLEQALLRGSDSPPLTLLLLDLDNFKPINDSL
GHAAGDAVLQEVATRLRDTTRDGDLVARLGGDEFILVLSGMDNSSEIDRFCARLIGLLQQ
PIVFENQPLHIGASIGVAQTRNQGFDAGELIRCADIALYQAKADGKNTWRYFVAEMNQQI
QYRRQLENDLRRALRNEEFELHYQPRYRLDDLRIVAVEALVRWRHPQEGLLAPDTFIPLA
EQSDIIVALGRWVLREACRTAHDWPADVLVSVNLSPAQFLRSDVVADVRETLLDTAFPAQ
RLELEITENVMLNDIEGALGTMLSLKELGVRLNMDDFGTGYSSLGYLRTYPFDSIKIDKR
FISGLNNNGGSDRAVVQAIINLGEAMGLTVTAEGVESEHQLKSLEKDRCHEVQGYYLSKP
LDSAGLTALLHQPSQNTAQPL