Protein Info for PP_1152 in Pseudomonas putida KT2440

Annotation: putative membrane fusion efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 42 to 234 (193 residues), 124.2 bits, see alignment E=2.8e-40 PF16576: HlyD_D23" amino acids 42 to 227 (186 residues), 59.2 bits, see alignment E=7.2e-20 PF13533: Biotin_lipoyl_2" amino acids 43 to 87 (45 residues), 53.9 bits, see alignment 2.5e-18 PF13437: HlyD_3" amino acids 153 to 240 (88 residues), 50.5 bits, see alignment E=6.1e-17

Best Hits

Swiss-Prot: 45% identical to YDHJ_ECOLI: Uncharacterized protein YdhJ (ydhJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1152)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NQ3 at UniProt or InterPro

Protein Sequence (289 amino acids)

>PP_1152 putative membrane fusion efflux protein (Pseudomonas putida KT2440)
MRAAVRILVTLCVVALAVLAGYQLWQYYMLTPWTRDARVRADVVVIAPDVSGWVRELKVH
DNQQVKAGDLLMSIDRERFQAALDQASAVTETRAQQLRLREREAARRTALGPEAISAELR
ENAQINAAIARGELHEAEAQLQVARINLARSEVRAPRSGHITNLRLAEGNYVNTGESVMA
LVDDSTFYIQAYFEETKLPRIRVGDTVKVWLMGTGEPMQGHVESISRGITDRNSNPDSQL
LPEVEPTFNWVRLAQRIPVRIRLDQVPEGLTLSAGMTASVQVHEDREPQ