Protein Info for PP_1145 in Pseudomonas putida KT2440

Annotation: RNA polymerase-associated protein RapA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 948 PF18339: Tudor_1_RapA" amino acids 5 to 55 (51 residues), 78.3 bits, see alignment 1.2e-25 PF18337: Tudor_RapA" amino acids 57 to 118 (62 residues), 75.7 bits, see alignment 9.3e-25 PF00176: SNF2-rel_dom" amino acids 132 to 351 (220 residues), 49.7 bits, see alignment E=1e-16 PF04851: ResIII" amino acids 157 to 315 (159 residues), 41.3 bits, see alignment E=5.4e-14 PF00270: DEAD" amino acids 171 to 315 (145 residues), 28.4 bits, see alignment E=4.4e-10 PF00271: Helicase_C" amino acids 474 to 584 (111 residues), 59.3 bits, see alignment E=1.4e-19 PF12137: RapA_C" amino acids 588 to 946 (359 residues), 462.5 bits, see alignment E=3.5e-142

Best Hits

Swiss-Prot: 100% identical to RAPA_PSEPK: RNA polymerase-associated protein RapA (rapA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03580, ATP-dependent helicase HepA [EC: 3.6.4.-] (inferred from 100% identity to ppu:PP_1145)

Predicted SEED Role

"RNA polymerase associated protein RapA (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.-

Use Curated BLAST to search for 3.6.1.- or 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NR0 at UniProt or InterPro

Protein Sequence (948 amino acids)

>PP_1145 RNA polymerase-associated protein RapA (Pseudomonas putida KT2440)
MAQQYQPGQRWISDSEAELGLGTILAQDGRLLTVLYPATGDTRQYSLRNAPLTRVRFSPG
DQITHFEGWKLTVREVEDIDGLMVYHGLDGQNQPRTLPETQLSNFIQFRLASDRLFAGQI
DPLSWFSLRYNTLQHTSKQMQSALWGLGGCRAQPIAHQLHIAREVADRSAPRVLLADEVG
LGKTIEAGLVIHRQLLSGRASRVLILVPENLQHQWLVEMRRRFNLQVALFDAERFIESDA
SNPFEDAQLALVALEWLVDDEKAQDALFAAGWDLLVVDEAHHLVWHEDQVSAEYGLVEQL
AQVIPGVLLLTATPEQLGQDSHFARLRLLDPNRFHDLAAFRAESEHYRPVAEAVQELLDE
GRLSPKAHATILGFLGAEGEALLAAVSDGDTQASARLIRELLDRHGTGRVLFRNTRAAIQ
GFPERQLHPYPLPTPEQYRDLPAGEHAELYPEVAFQAQGEVADDERWWRFDPRVDWLIDT
LKMLKRTKVLVICAHAETAMDLEDALRVRSGIPASVFHEGMSILERDRAAAYFADEEFGA
QVLICSEIGSEGRNFQFAHHLVMFDLPAHPDLLEQRIGRLDRIGQKHTIQLHIPYLQDSP
QERLFQWYHEGLNAFLNTCPTGNALQHQFGPRLLPLLEGGENKAWDTLVADARSERERLE
AELHTGRDRLLELNSGGAGEGQALVEAILEQDDQFALPIYMETLFDAFGIDSEDHSENAL
ILKPSEKMLDASFPLGDDEGVTITYDRGQALSREDMQFLTWEHPMVQGGMDLVLSGSMGN
TAVALIKNKALKPGTVLLELLFVSEVVAPRSLQLGRYLPPAALRCLLDANGNDLASRVAF
ETLNDQLESVPRASANKFVQAQRDVLAKRISGGEEKILPAHNERVAEAQRRLAAEADEEL
ARLVALQAVNPSVRDSEIDALRKRREDGLAMLEKAALRLEAIRVLVAG