Protein Info for PP_1112 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 227 (205 residues), 35 bits, see alignment E=4e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1112)

Predicted SEED Role

"FIG00956392: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NU2 at UniProt or InterPro

Protein Sequence (403 amino acids)

>PP_1112 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MNSTLPRRTYLYFTAQSINLTTAVMSVTMAAIVGAALAPDAAWSTVPYGFQFLCLMLATY
PVSRLMSRIGRKKAFMLGAIPLALSGVSGFLAVEHQHFPTLVLSHSALGVYIAFANFNRF
AATDNLSQALKPKALSLVVAGGVIAAVVGPTLTEWLRDVGGYPLFSLCYAAFVGLALLSL
LIALCLPNDAGMARAVNSAAKPASVRAEPAGPSVVVAMAVAALGYGIMNLLMIQASMHMK
HMHEDFTDVRLAIQWHVIAMFAPSFFTGAIIQRLGIKTTICAGLALLIGCSAMNIWSHSY
AMMTLALIALGLGWNLTYVGGGALLAQSLQNSPAAMQMQGKNDLAIAIFATLGAFSPSLL
LSSVGWDGTNAICMVLCLGLLVATAGLLQNKVGLQTSMEGSRK