Protein Info for PP_1098 in Pseudomonas putida KT2440

Annotation: ATP-dependent Fe-S cluster transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF01883: FeS_assembly_P" amino acids 6 to 77 (72 residues), 67.5 bits, see alignment E=3.6e-22 PF10609: ParA" amino acids 97 to 342 (246 residues), 336.5 bits, see alignment E=3.3e-104 PF13614: AAA_31" amino acids 100 to 138 (39 residues), 36.7 bits, see alignment 1.5e-12 PF09140: MipZ" amino acids 101 to 222 (122 residues), 34.8 bits, see alignment E=4.1e-12 PF01656: CbiA" amino acids 102 to 271 (170 residues), 53.2 bits, see alignment E=1e-17 PF02374: ArsA_ATPase" amino acids 104 to 137 (34 residues), 22.4 bits, see alignment 2.4e-08

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 100% identity to ppf:Pput_1138)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NV6 at UniProt or InterPro

Protein Sequence (364 amino acids)

>PP_1098 ATP-dependent Fe-S cluster transferase (Pseudomonas putida KT2440)
MSAVTRAAVEGVLRQYTDPYLNQDPVSAGCVRAIDIQGGQVSVQLQLGYAAGLFKNGWAQ
VLQAAIGSLEGVTGAQVSIDCVVAAHKAQAQVPSMANVKNIIAVASGKGGVGKSTTAANL
ALALAREGARVGILDADIYGPSQGVMFGIAEGTRPQIREQKWFVPIKAHGVEVMSMAFLT
DDNTPMVWRGPMVSGALLQLVTQTAWDDLDYLVIDMPPGTGDIQLTLAQKVPVVGSVIVT
TPQDLALLDAKKGVEMFRKVNIPVLGVVENMAVHICSNCGHAEHLFGEGGGEKLASQYGV
DLLASLPLSMLIREQADSGKPTAIAEPESQIAMVYQELARQVGARIVLQEAAAPAMPSIT
ISED