Protein Info for PP_1076 in Pseudomonas putida KT2440
Annotation: aquaglyceroporin
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 84% identical to GLPF_PSEAE: Glycerol uptake facilitator protein (glpF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K02440, glycerol uptake facilitator protein (inferred from 100% identity to ppu:PP_1076)MetaCyc: 74% identical to glycerol facilitator (Escherichia coli K-12 substr. MG1655)
RXN0-7189; RXN0-7191; TRANS-RXN-131; TRANS-RXN0-460; TRANS-RXN0-536; TRANS-RXN0-537; TRANS-RXN0-551
Predicted SEED Role
"Glycerol uptake facilitator protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerol fermenation to 1,3-propanediol
MetaCyc Pathways
- glycerol and glycerophosphodiester degradation (4/4 steps found)
- glycerol degradation I (3/3 steps found)
- arsenate detoxification III (2/2 steps found)
- arsenic detoxification (plants) (4/6 steps found)
- arsenic detoxification (mammals) (8/17 steps found)
- arsenic detoxification (yeast) (4/12 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88NX7 at UniProt or InterPro
Protein Sequence (283 amino acids)
>PP_1076 aquaglyceroporin (Pseudomonas putida KT2440) MTTALRQPTLSSQCLAEFLGTALLIFFGTGCVAALKVAGASFGLWEISIIWGVGVSMAIY LTAGISGAHLNPAVSIALTLFAGFDKRKLPFYMLAQVCGAFCGAALVYTLYSNLFFDFEQ AHAMLRGSEGSLELASVFSTYPHPSLSTSQAFLVEVVITAILMAVIMALTDDNNGLPRGA MAPLLIGLLIAVIGSAMGPLTGFAMNPARDFGPKLMTFLAGWGEIAFTGGRDIPYFLVPV FAPILGACLGAASYRGLIARNLPMAPAATPETNDIRQGDTQAN