Protein Info for PP_1066 in Pseudomonas putida KT2440

Annotation: C4-dicarboxylate transport transcriptional regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 PF00072: Response_reg" amino acids 8 to 117 (110 residues), 95.9 bits, see alignment E=5.9e-31 PF00158: Sigma54_activat" amino acids 147 to 313 (167 residues), 233.4 bits, see alignment E=4.5e-73 PF14532: Sigma54_activ_2" amino acids 148 to 318 (171 residues), 71.8 bits, see alignment E=2.6e-23 PF07728: AAA_5" amino acids 170 to 287 (118 residues), 27.3 bits, see alignment E=1.1e-09 PF25601: AAA_lid_14" amino acids 319 to 375 (57 residues), 68.4 bits, see alignment 1.4e-22 PF02954: HTH_8" amino acids 399 to 439 (41 residues), 39.8 bits, see alignment 1e-13

Best Hits

Swiss-Prot: 58% identical to DCTD_PSEAE: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 100% identity to ppf:Pput_1107)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NY7 at UniProt or InterPro

Protein Sequence (442 amino acids)

>PP_1066 C4-dicarboxylate transport transcriptional regulatory protein (Pseudomonas putida KT2440)
MNQAPLTVLIVEDDPHVLLGCQQALALEDIACEGVGSAEQALERIGDDFAGIVVSDIRLP
GIDGLELLNRLKARDRSLPVVLITGHGDIDMAVGAMRNGAYDFMEKPFSPERLVDVVRRA
LEQRGLSREVVALRRQLAEQSSLEGRIIGRSPAMEHLRELIANVADTSANVLIEGETGTG
KELVARCLHDFSRRQSHPFVALNCGGLPENLFESEIFGHEANAFTGAGKRRIGKIEHANG
GTLFLDEVESMPINLQIKLLRVLQERTLERLGSNQSIPVDCRVIAATKADLDALGQSGQF
RSDLYYRLNVVTLELPPLRERREDILQLFEHFLQQSALRFDRETPTLDSQTLSRLMAHDW
PGNVRELRNVAERYALGLPAFKKGPSGGANQGLLFAEAVEAFERNLLTDALQRTGGNLSQ
ASQELGMAKTTLFDKVKKYGLA